PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G143800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 243aa    MW: 28280.3 Da    PI: 8.6041
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G143800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.1e-181259148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd ll+++++ +G g+W++++ + g++R++k+c++rw++yl
  Aqcoe6G143800.1.p 12 KGAWTEEEDRLLKKCIEIHGEGNWHKVPLRAGLNRCRKSCRLRWFNYL 59
                       79********************************************97 PP

2Myb_DNA-binding45.91.3e-1465109147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg +  +E +l+++ +k+lG++ W++Ia++++ gRt++++k+rw+++
  Aqcoe6G143800.1.p  65 RGEFAWDEIDLIIRMHKLLGNR-WSLIAARLP-GRTANDIKNRWNTH 109
                        6778889***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.844763IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-211062IPR009057Homeodomain-like
SuperFamilySSF466896.12E-2810106IPR009057Homeodomain-like
SMARTSM007172.2E-161161IPR001005SANT/Myb domain
PfamPF002493.3E-171259IPR001005SANT/Myb domain
CDDcd001671.64E-111459No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2263114IPR009057Homeodomain-like
SMARTSM007171.5E-1464112IPR001005SANT/Myb domain
PROSITE profilePS5129419.2764114IPR017930Myb domain
PfamPF002491.8E-1365109IPR001005SANT/Myb domain
CDDcd001672.06E-971110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRGTCSFTL NKGAWTEEED RLLKKCIEIH GEGNWHKVPL RAGLNRCRKS CRLRWFNYLH  60
PNIKRGEFAW DEIDLIIRMH KLLGNRWSLI AARLPGRTAN DIKNRWNTHI HKSLQKKPSV  120
LMKQISTTET ITTHQKIKVL KPQPRTLSKK SQWMMKNTYS NSIEKTTTQC REVQNDEQIS  180
TKWWENLLFD VEEDDKETSS GSKDEFAIID DSFSHDGFVP NETSMLIGDG LDMCLDMNLW  240
ET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A3e-20121142103MYB3
3zqc_D3e-20121142103MYB3
3zqc_G3e-20121142103MYB3
3zqc_J3e-20121142103MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275818.16e-66Myb transcription factor
SwissprotQ9FNV91e-59MY113_ARATH; Transcription factor MYB113
TrEMBLH6U1F17e-66H6U1F1_CITSI; Myb transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.17e-61myb domain protein 113